Drosophila embryos were selected at successive stages of early development for RNA extraction and hybridization on Affymetrix microarrays. We sought to obtain homogeneous populations of embryos …
Mar 15, 2024 · Gene symbol. Ugt1a1. Ugt1a2. UGT1A2P. Ugt1a3. UGT1A3. UGT1A4. Ugt1a5. UGT1A5. Ugt1a6. UGT1A6. Ugt1a6a. Ugt1a6b. Ugt1a7. A2. UGT1A7. Ugt1a7c. Ugt1a8. UGT1A8. …
- [XLS]
Broad Institute
bbbc002 training cell_type kc167-drosophila ht29-human-colon-cancer u2os-human-osteosarcoma human-fibroblast
Lactate Synthesis malic enzyme List of Drosophila metabolic genes (Supplemental Table 2 from Tennessen et al., 2014. Coordinated Metabolic Transitions During Drosophila Embryogenesis and …
- [XLS]
NASA
2 days ago · 3D Printed Antenna Feedhorn. On-Orbit Validation of Additive Manufacturing of High Frequency Microwave Components in Microgravity. Barry Geldzahler, Ph.D., NASA Headquarters, …
- [XLS]
ResearchGate
ENSGALG00000008096 ENSGALT00000013142 SUFU Suppressor of fused homolog (Drosophila) D111E, ENSGALG00000008100 ENSGALT00000013147
- [XLS]
www.oglcnac.mcw.edu
MKIFLPLVTWIVLLLSSAVHSQYSQQPQPFKTNLRANSRFRGEVFYLNLENGYFGCQVNESTEYLQLFNLSKLCDGTQDCFLGADELSKELKCTNDCDKDGTKCTHGACLNGVCHCNDGYGGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHC ...
- [XLS]
EPFL
putative antimicrobial activity.
Desmodesmus subspicatus (Scenedesmus subspicatus) Dictosphaerium pulchellum Dorosoma petenese Drosophila melanogaster Dunaliella bioculata Dunaliella salina Dunaliella tertiolecta
- [XLS]
arpha.pensoft.net
Hermetia illucens (Linnaeus, 1758) Family Drosophilidae Drosophila melanogaster Meigen, 1830 Order Lepidoptera Family Tortricidae